rincian perusahaan
  • Conbott Pharmtech Co.,Ltd.

  •  [Zhejiang,China]
  • Jenis usaha:Pabrikan
  • Main Mark: Afrika , Amerika , Asia , Karibia , Eropa Timur , Eropa , Timur Tengah , Eropa Utara , Oceania , Pasar lainnya , Eropa Barat , Di seluruh dunia
  • eksportir:71% - 80%
  • karts:COS, ISO9001, ISO14010, FDA
  • deskripsi:106612-94-6,CAS 106612-94-6,CAS NO 106612-94-6
Conbott Pharmtech Co.,Ltd. 106612-94-6,CAS 106612-94-6,CAS NO 106612-94-6
Rumah > Produk > Sintesis peptida > 99% Hormon Pertumbuhan Manusia Peptida GLP-1 CAS 106612-94-6

99% Hormon Pertumbuhan Manusia Peptida GLP-1 CAS 106612-94-6

Berbagi ke:  
    Jenis pembayaran: T/T,L/C
    Min. Memesan: 1 Gram
    Waktu pengiriman: 10 Hari
  • Mr. Tommy

Info dasar

Model No: 106612-94-6

Additional Info

Kemasan: Seperti yang dipersyaratkan

Produktivitas: Customized

Merek: Conbottpharm

Transportasi: Ocean,Air

Tempat asal: Cina

Kemampuan Supply: Commercial

Sertifikat: Documents Support

Deskripsi Produk

Kami menawarkan kualitas yang hebat dan kemurnian tinggi GLP-1 CAS 106612-94-6. Glukagon like peptide -1 (GLP-1) adalah otak peptida usus sekresi sel endokrin ileum, saat ini terutama sebagai target untuk tipe 2 diabetes kerja obat. Keuntungan dari GLP- 1 CAS 106612-94-6 dapat mengurangi penghambatan pengosongan lambung, gerak peristaltik usus. Hal ini memberikan prospek yang sangat baik untuk pengobatan diabetes melitus tipe 2. Tetapi karena GLP-1 adalah polipeptida, tidak dapat diberikan secara oral adalah kelemahan utama. Kami terampil untuk menghasilkan GLP- kemurnian tinggi 1. Kami dapat menyediakan kemasan yang berbeda untuk memenuhi kebutuhan pelanggan.


Thera. Kategori: Anti-diabetes tipe 2

Cas No. : 106612-94-6

Sinonim: PROGLUCAGON (78-108) (MANUSIA, BOVINE, GUINEA PIG, MOUSE, RAT); PREPROGLUCAGON 78-108 MANUSIA; PREPROGLUCAGON (98-128) (MANUSIA, BOVINE, GUINEA PIG, MOUSE, RAT); INSULINOTROPIN (MANUSIA, BOVINE, GUINEA PIG, MOUSE, RAT); HIS-ALA-Glu-Gly-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-Glu-Gly-GLN-ALA-ALA-LYS-Glu-PHE-ILE-ALA-TRP- LEU-VAL-LYS-Gly-ARG-Gly; H-HIS-ALA-Glu-Gly-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-Glu-Gly-GLN-ALA-ALA-LYS-Glu-PHE-ILE-Ala TRP-LEU-VAL-LYS-Gly-ARG-Gly-OH; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; GLP-1 (MANUSIA, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG)


106612-94-6


Formula Molekul: C151H228N40O47

Molekul Timbang t: 3.355,67

Assay:. ≥99%

Packing: packing layak Ekspor

Lembar lMaterial data keselamatan: Tersedia atas permintaan

Penggunaan: GLP-1 jelas dapat meningkatkan glukosa darah pada hewan model diabetes tipe 2 atau pasien melalui berbagai mekanisme, yang mempromosikan regenerasi dan perbaikan sel-sel beta pulau, meningkatkan jumlah sel beta adalah peran yang sangat signifikan


Kategori Produk : Sintesis peptida

Gambar produk
  • 99% Hormon Pertumbuhan Manusia Peptida GLP-1 CAS 106612-94-6
Email ke pemasok ini
  • *Subjek:
  • *Pesan:
    Pesan Anda harus antara 20-8000 karakter

Handphone Website Indeks. Peta Situs


Daftar ke newsletter kami:
Dapatkan update, diskon, Spesial
Penawaran dan hadiah besar!

Multi-bahasa:
Hak cipta © 2019 Conbott Pharmtech Co.,Ltd. semua hak dilindungi.
Berkomunikasi dengan pemasok?Pemasok
Tommy Mr. Tommy
Apa yang dapat saya lakukan untuk Anda?
Hubungi pemasok